Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 9,176
  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 11,075
  2. Avatar for LociOiling 2. LociOiling Lv 1 82 pts. 11,073
  3. Avatar for Deleted player 3. Deleted player 66 pts. 11,061
  4. Avatar for reefyrob 4. reefyrob Lv 1 53 pts. 11,035
  5. Avatar for dbuske 5. dbuske Lv 1 42 pts. 11,015
  6. Avatar for georg137 6. georg137 Lv 1 33 pts. 11,013
  7. Avatar for Galaxie 7. Galaxie Lv 1 26 pts. 10,967
  8. Avatar for Bletchley Park 8. Bletchley Park Lv 1 20 pts. 10,953
  9. Avatar for robgee 9. robgee Lv 1 15 pts. 10,945
  10. Avatar for gdnskye 10. gdnskye Lv 1 11 pts. 10,939

Comments