Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 9,176
  1. Avatar for frostschutz 91. frostschutz Lv 1 5 pts. 9,651
  2. Avatar for NR22 92. NR22 Lv 1 5 pts. 9,640
  3. Avatar for harvardman 93. harvardman Lv 1 4 pts. 9,635
  4. Avatar for ViJay7019 94. ViJay7019 Lv 1 4 pts. 9,620
  5. Avatar for Merf 95. Merf Lv 1 4 pts. 9,618
  6. Avatar for poltix 96. poltix Lv 1 4 pts. 9,609
  7. Avatar for lconor 97. lconor Lv 1 4 pts. 9,606
  8. Avatar for Alistair69 98. Alistair69 Lv 1 3 pts. 9,595
  9. Avatar for cobaltteal 99. cobaltteal Lv 1 3 pts. 9,584
  10. Avatar for Altercomp 100. Altercomp Lv 1 3 pts. 9,580

Comments