Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 9,176

  1. Avatar for Znaika 101. Znaika Lv 1 3 pts. 9,573
  2. Avatar for Pibeagles1 102. Pibeagles1 Lv 1 3 pts. 9,563
  3. Avatar for estrozi 103. estrozi Lv 1 3 pts. 9,545
  4. Avatar for aspadistra 104. aspadistra Lv 1 3 pts. 9,489
  5. Avatar for oureion 105. oureion Lv 1 3 pts. 9,485
  6. Avatar for icaru-5 106. icaru-5 Lv 1 2 pts. 9,473
  7. Avatar for TePie 107. TePie Lv 1 2 pts. 9,449
  8. Avatar for SouperGenious 108. SouperGenious Lv 1 2 pts. 9,442
  9. Avatar for Flagg65a 109. Flagg65a Lv 1 2 pts. 9,428
  10. Avatar for rinze 110. rinze Lv 1 2 pts. 9,426

Comments