Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 9,176

  1. Avatar for cleanrig 131. cleanrig Lv 1 1 pt. 9,004
  2. Avatar for anjali0915 133. anjali0915 Lv 1 1 pt. 8,926
  3. Avatar for Sahaj_Singh 134. Sahaj_Singh Lv 1 1 pt. 8,917
  4. Avatar for KAOSkonfused 135. KAOSkonfused Lv 1 1 pt. 8,905
  5. Avatar for TheRukk 136. TheRukk Lv 1 1 pt. 8,887
  6. Avatar for yavij2019 137. yavij2019 Lv 1 1 pt. 8,865
  7. Avatar for dreeee 138. dreeee Lv 1 1 pt. 8,846
  8. Avatar for Nicole1221 139. Nicole1221 Lv 1 1 pt. 8,841
  9. Avatar for Willyanto 140. Willyanto Lv 1 1 pt. 8,811

Comments