Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 9,176

  1. Avatar for Chinmay Mahajan 141. Chinmay Mahajan Lv 1 1 pt. 8,808
  2. Avatar for Sanyog Ghosh 142. Sanyog Ghosh Lv 1 1 pt. 8,796
  3. Avatar for nikhilgargbits 143. nikhilgargbits Lv 1 1 pt. 8,796
  4. Avatar for Utkarsh1308 144. Utkarsh1308 Lv 1 1 pt. 8,785
  5. Avatar for rushil_gupta 145. rushil_gupta Lv 1 1 pt. 8,762
  6. Avatar for mayurak47 146. mayurak47 Lv 1 1 pt. 8,754
  7. Avatar for shubhamgarg227 147. shubhamgarg227 Lv 1 1 pt. 8,749
  8. Avatar for apoorvb 148. apoorvb Lv 1 1 pt. 8,748
  9. Avatar for congautruc 149. congautruc Lv 1 1 pt. 8,737
  10. Avatar for anuragkumar08 150. anuragkumar08 Lv 1 1 pt. 8,730

Comments