Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 9,176

  1. Avatar for akrohit 181. akrohit Lv 1 1 pt. 8,476
  2. Avatar for Artoria2e5 182. Artoria2e5 Lv 1 1 pt. 8,474
  3. Avatar for Gemmer0 183. Gemmer0 Lv 1 1 pt. 8,367
  4. Avatar for RockOn 184. RockOn Lv 1 1 pt. 8,347
  5. Avatar for jaredmason24 185. jaredmason24 Lv 1 1 pt. 8,129
  6. Avatar for fdmendoza 186. fdmendoza Lv 1 1 pt. 8,115
  7. Avatar for ShikharPandey 187. ShikharPandey Lv 1 1 pt. 8,085
  8. Avatar for 01010011111 188. 01010011111 Lv 1 1 pt. 8,025
  9. Avatar for Unsleeper 189. Unsleeper Lv 1 1 pt. 7,736
  10. Avatar for sa_simsalabim 190. sa_simsalabim Lv 1 1 pt. 5,851

Comments