Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 9,176
  1. Avatar for DoctorSockrates 41. DoctorSockrates Lv 1 32 pts. 10,634
  2. Avatar for georg137 42. georg137 Lv 1 31 pts. 10,623
  3. Avatar for aznarog 43. aznarog Lv 1 30 pts. 10,608
  4. Avatar for dcrwheeler 44. dcrwheeler Lv 1 29 pts. 10,602
  5. Avatar for pvc78 45. pvc78 Lv 1 28 pts. 10,602
  6. Avatar for johnmitch 46. johnmitch Lv 1 27 pts. 10,600
  7. Avatar for Bautho 47. Bautho Lv 1 26 pts. 10,586
  8. Avatar for Anfinsen_slept_here 48. Anfinsen_slept_here Lv 1 25 pts. 10,584
  9. Avatar for tarimo 49. tarimo Lv 1 24 pts. 10,584
  10. Avatar for hansvandenhof 50. hansvandenhof Lv 1 23 pts. 10,578

Comments