Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 9,176
  1. Avatar for diamonddays 51. diamonddays Lv 1 23 pts. 10,571
  2. Avatar for jausmh 52. jausmh Lv 1 22 pts. 10,559
  3. Avatar for smilingone 53. smilingone Lv 1 21 pts. 10,522
  4. Avatar for Skippysk8s 54. Skippysk8s Lv 1 20 pts. 10,518
  5. Avatar for joremen 55. joremen Lv 1 20 pts. 10,481
  6. Avatar for anthion 56. anthion Lv 1 19 pts. 10,464
  7. Avatar for Crossed Sticks 57. Crossed Sticks Lv 1 18 pts. 10,433
  8. Avatar for 181818 58. 181818 Lv 1 18 pts. 10,430
  9. Avatar for stomjoh 59. stomjoh Lv 1 17 pts. 10,411
  10. Avatar for Hellcat6 60. Hellcat6 Lv 1 16 pts. 10,399

Comments