Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 9,176
  1. Avatar for heather-1 71. heather-1 Lv 1 11 pts. 10,200
  2. Avatar for phi16 72. phi16 Lv 1 10 pts. 10,173
  3. Avatar for Arne Heessels 73. Arne Heessels Lv 1 10 pts. 10,167
  4. Avatar for alwen 74. alwen Lv 1 10 pts. 10,164
  5. Avatar for WBarme1234 75. WBarme1234 Lv 1 9 pts. 10,150
  6. Avatar for PlagueRat 76. PlagueRat Lv 1 9 pts. 10,132
  7. Avatar for O Seki To 77. O Seki To Lv 1 9 pts. 10,124
  8. Avatar for cbwest 78. cbwest Lv 1 8 pts. 10,071
  9. Avatar for pfirth 79. pfirth Lv 1 8 pts. 10,064
  10. Avatar for nathanmills 80. nathanmills Lv 1 8 pts. 10,063

Comments