Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 9,176
  1. Avatar for rezaefar 81. rezaefar Lv 1 7 pts. 10,063
  2. Avatar for andromeda72 82. andromeda72 Lv 1 7 pts. 10,041
  3. Avatar for Squirrely 83. Squirrely Lv 1 7 pts. 10,029
  4. Avatar for Jesse Pinkman 84. Jesse Pinkman Lv 1 6 pts. 9,970
  5. Avatar for benrh 85. benrh Lv 1 6 pts. 9,955
  6. Avatar for JasperD 86. JasperD Lv 1 6 pts. 9,927
  7. Avatar for dbuske 87. dbuske Lv 1 6 pts. 9,903
  8. Avatar for johngran 88. johngran Lv 1 5 pts. 9,830
  9. Avatar for vizhu2018 89. vizhu2018 Lv 1 5 pts. 9,810
  10. Avatar for RyeSnake 90. RyeSnake Lv 1 5 pts. 9,796

Comments