Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Beta Folders 100 pts. 11,075
  2. Avatar for Contenders 2. Contenders 78 pts. 11,032
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 11,030
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,967
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,940
  6. Avatar for Go Science 6. Go Science 24 pts. 10,891
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 10,848
  8. Avatar for Gargleblasters 8. Gargleblasters 12 pts. 10,809
  9. Avatar for Russian team 9. Russian team 8 pts. 10,757
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,215

  1. Avatar for Znaika 101. Znaika Lv 1 3 pts. 9,573
  2. Avatar for Pibeagles1 102. Pibeagles1 Lv 1 3 pts. 9,563
  3. Avatar for estrozi 103. estrozi Lv 1 3 pts. 9,545
  4. Avatar for aspadistra 104. aspadistra Lv 1 3 pts. 9,489
  5. Avatar for oureion 105. oureion Lv 1 3 pts. 9,485
  6. Avatar for icaru-5 106. icaru-5 Lv 1 2 pts. 9,473
  7. Avatar for TePie 107. TePie Lv 1 2 pts. 9,449
  8. Avatar for SouperGenious 108. SouperGenious Lv 1 2 pts. 9,442
  9. Avatar for Flagg65a 109. Flagg65a Lv 1 2 pts. 9,428
  10. Avatar for rinze 110. rinze Lv 1 2 pts. 9,426

Comments