Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Beta Folders 100 pts. 11,075
  2. Avatar for Contenders 2. Contenders 78 pts. 11,032
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 11,030
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,967
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,940
  6. Avatar for Go Science 6. Go Science 24 pts. 10,891
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 10,848
  8. Avatar for Gargleblasters 8. Gargleblasters 12 pts. 10,809
  9. Avatar for Russian team 9. Russian team 8 pts. 10,757
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,215

  1. Avatar for manu8170 21. manu8170 Lv 1 58 pts. 10,773
  2. Avatar for orily1337 22. orily1337 Lv 1 57 pts. 10,771
  3. Avatar for Blipperman 23. Blipperman Lv 1 55 pts. 10,764
  4. Avatar for altejoh 24. altejoh Lv 1 53 pts. 10,762
  5. Avatar for MicElephant 25. MicElephant Lv 1 52 pts. 10,760
  6. Avatar for vakobo 26. vakobo Lv 1 50 pts. 10,757
  7. Avatar for fpc 27. fpc Lv 1 49 pts. 10,745
  8. Avatar for Deleted player 28. Deleted player 47 pts. 10,735
  9. Avatar for guineapig 29. guineapig Lv 1 46 pts. 10,727
  10. Avatar for Sissue 30. Sissue Lv 1 45 pts. 10,721

Comments