Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 5 pts. 8,843
  2. Avatar for freefolder 12. freefolder 4 pts. 8,808
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 8,781
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,765
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,713
  6. Avatar for GENE 433 16. GENE 433 1 pt. 8,709
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,657
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,305
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 8,293

  1. Avatar for gdnskye
    1. gdnskye Lv 1
    100 pts. 9,251
  2. Avatar for tyler0911 2. tyler0911 Lv 1 97 pts. 9,226
  3. Avatar for O Seki To 3. O Seki To Lv 1 94 pts. 9,225
  4. Avatar for MicElephant 4. MicElephant Lv 1 91 pts. 9,195
  5. Avatar for robgee 5. robgee Lv 1 89 pts. 9,172
  6. Avatar for actiasluna 6. actiasluna Lv 1 86 pts. 9,171
  7. Avatar for LociOiling 7. LociOiling Lv 1 83 pts. 9,169
  8. Avatar for ZeroLeak7 8. ZeroLeak7 Lv 1 80 pts. 9,161
  9. Avatar for smilingone 9. smilingone Lv 1 78 pts. 9,157
  10. Avatar for johnmitch 10. johnmitch Lv 1 75 pts. 9,156

Comments