Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 8,157
  2. Avatar for Team China 22. Team China 1 pt. 8,046
  3. Avatar for Rice Biochemistry 301 2020_2021 23. Rice Biochemistry 301 2020_2021 1 pt. 5,091
  1. Avatar for gdnskye
    1. gdnskye Lv 1
    100 pts. 9,251
  2. Avatar for tyler0911 2. tyler0911 Lv 1 97 pts. 9,226
  3. Avatar for O Seki To 3. O Seki To Lv 1 94 pts. 9,225
  4. Avatar for MicElephant 4. MicElephant Lv 1 91 pts. 9,195
  5. Avatar for robgee 5. robgee Lv 1 89 pts. 9,172
  6. Avatar for actiasluna 6. actiasluna Lv 1 86 pts. 9,171
  7. Avatar for LociOiling 7. LociOiling Lv 1 83 pts. 9,169
  8. Avatar for ZeroLeak7 8. ZeroLeak7 Lv 1 80 pts. 9,161
  9. Avatar for smilingone 9. smilingone Lv 1 78 pts. 9,157
  10. Avatar for johnmitch 10. johnmitch Lv 1 75 pts. 9,156

Comments