Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 5 pts. 8,843
  2. Avatar for freefolder 12. freefolder 4 pts. 8,808
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 8,781
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,765
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,713
  6. Avatar for GENE 433 16. GENE 433 1 pt. 8,709
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,657
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,305
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 8,293
  10. Avatar for Team Schleswig-Holstein 20. Team Schleswig-Holstein 1 pt. 8,208
  1. Avatar for ViJay7019 111. ViJay7019 Lv 1 1 pt. 8,460
  2. Avatar for frostschutz 112. frostschutz Lv 1 1 pt. 8,444
  3. Avatar for Willyanto 113. Willyanto Lv 1 1 pt. 8,436
  4. Avatar for molleke 114. molleke Lv 1 1 pt. 8,424
  5. Avatar for fobosfog 115. fobosfog Lv 1 1 pt. 8,412
  6. Avatar for alwan2018 116. alwan2018 Lv 1 1 pt. 8,404
  7. Avatar for Anfinsen_slept_here 117. Anfinsen_slept_here Lv 1 1 pt. 8,361
  8. Avatar for Knoblerine 118. Knoblerine Lv 1 1 pt. 8,361
  9. Avatar for congautruc 119. congautruc Lv 1 1 pt. 8,361
  10. Avatar for TePie 120. TePie Lv 1 1 pt. 8,341

Comments