Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 5 pts. 8,843
  2. Avatar for freefolder 12. freefolder 4 pts. 8,808
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 8,781
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,765
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,713
  6. Avatar for GENE 433 16. GENE 433 1 pt. 8,709
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,657
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,305
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 8,293
  10. Avatar for Team Schleswig-Holstein 20. Team Schleswig-Holstein 1 pt. 8,208
  1. Avatar for DeMers_253 131. DeMers_253 Lv 1 1 pt. 8,177
  2. Avatar for 01010011111 132. 01010011111 Lv 1 1 pt. 8,175
  3. Avatar for jdmclure 133. jdmclure Lv 1 1 pt. 8,174
  4. Avatar for Keegan12 134. Keegan12 Lv 1 1 pt. 8,157
  5. Avatar for wozzarelli 135. wozzarelli Lv 1 1 pt. 8,157
  6. Avatar for Auntecedent 136. Auntecedent Lv 1 1 pt. 8,149
  7. Avatar for ti_go_Mars 137. ti_go_Mars Lv 1 1 pt. 8,142
  8. Avatar for henur 138. henur Lv 1 1 pt. 8,131
  9. Avatar for Charybdiss 139. Charybdiss Lv 1 1 pt. 8,129
  10. Avatar for lamoille 140. lamoille Lv 1 1 pt. 8,126

Comments