Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 5 pts. 8,843
  2. Avatar for freefolder 12. freefolder 4 pts. 8,808
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 8,781
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,765
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,713
  6. Avatar for GENE 433 16. GENE 433 1 pt. 8,709
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,657
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,305
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 8,293
  10. Avatar for Team Schleswig-Holstein 20. Team Schleswig-Holstein 1 pt. 8,208
  1. Avatar for jhames 141. jhames Lv 1 1 pt. 8,117
  2. Avatar for memam2018 142. memam2018 Lv 1 1 pt. 8,116
  3. Avatar for Jesse Pinkman 143. Jesse Pinkman Lv 1 1 pt. 8,097
  4. Avatar for DipsyDoodle2016 144. DipsyDoodle2016 Lv 1 1 pt. 8,090
  5. Avatar for kerpowah 145. kerpowah Lv 1 1 pt. 8,081
  6. Avatar for 1488779 146. 1488779 Lv 1 1 pt. 8,057
  7. Avatar for Steven Pletsch 147. Steven Pletsch Lv 1 1 pt. 8,051
  8. Avatar for Kevin76 148. Kevin76 Lv 1 1 pt. 8,046
  9. Avatar for Reuben_Allen 149. Reuben_Allen Lv 1 1 pt. 8,030
  10. Avatar for nong9090 150. nong9090 Lv 1 1 pt. 7,998

Comments