Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 5 pts. 8,843
  2. Avatar for freefolder 12. freefolder 4 pts. 8,808
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 8,781
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,765
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,713
  6. Avatar for GENE 433 16. GENE 433 1 pt. 8,709
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,657
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,305
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 8,293
  10. Avatar for Team Schleswig-Holstein 20. Team Schleswig-Holstein 1 pt. 8,208
  1. Avatar for Galaxie 11. Galaxie Lv 1 73 pts. 9,154
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 71 pts. 9,135
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 68 pts. 9,133
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 66 pts. 9,118
  5. Avatar for Phyx 15. Phyx Lv 1 64 pts. 9,118
  6. Avatar for nicobul 16. nicobul Lv 1 62 pts. 9,111
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 60 pts. 9,109
  8. Avatar for reefyrob 18. reefyrob Lv 1 58 pts. 9,092
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 56 pts. 9,090
  10. Avatar for fiendish_ghoul 20. fiendish_ghoul Lv 1 54 pts. 9,078

Comments