Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 5 pts. 8,843
  2. Avatar for freefolder 12. freefolder 4 pts. 8,808
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 8,781
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,765
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,713
  6. Avatar for GENE 433 16. GENE 433 1 pt. 8,709
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,657
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,305
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 8,293
  10. Avatar for Team Schleswig-Holstein 20. Team Schleswig-Holstein 1 pt. 8,208
  1. Avatar for frood66 41. frood66 Lv 1 24 pts. 8,948
  2. Avatar for katling 42. katling Lv 1 23 pts. 8,945
  3. Avatar for jobo0502 43. jobo0502 Lv 1 22 pts. 8,935
  4. Avatar for WBarme1234 44. WBarme1234 Lv 1 21 pts. 8,920
  5. Avatar for diamonddays 45. diamonddays Lv 1 21 pts. 8,913
  6. Avatar for cbwest 46. cbwest Lv 1 20 pts. 8,908
  7. Avatar for crpainter 47. crpainter Lv 1 19 pts. 8,907
  8. Avatar for Vinara 48. Vinara Lv 1 18 pts. 8,888
  9. Avatar for georg137 49. georg137 Lv 1 17 pts. 8,887
  10. Avatar for Bletchley Park 50. Bletchley Park Lv 1 17 pts. 8,883

Comments