Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 5 pts. 8,843
  2. Avatar for freefolder 12. freefolder 4 pts. 8,808
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 8,781
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,765
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,713
  6. Avatar for GENE 433 16. GENE 433 1 pt. 8,709
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,657
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,305
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 8,293

  1. Avatar for Museka 51. Museka Lv 1 16 pts. 8,867
  2. Avatar for RyeSnake 52. RyeSnake Lv 1 15 pts. 8,859
  3. Avatar for Aminal88 53. Aminal88 Lv 1 15 pts. 8,843
  4. Avatar for Glen B 54. Glen B Lv 1 14 pts. 8,827
  5. Avatar for joremen 55. joremen Lv 1 13 pts. 8,826
  6. Avatar for aznarog 56. aznarog Lv 1 13 pts. 8,822
  7. Avatar for Idiotboy 57. Idiotboy Lv 1 12 pts. 8,822
  8. Avatar for jamiexq 58. jamiexq Lv 1 12 pts. 8,819
  9. Avatar for Sissue 59. Sissue Lv 1 11 pts. 8,818
  10. Avatar for Crossed Sticks 60. Crossed Sticks Lv 1 11 pts. 8,810

Comments