Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 8,157
  2. Avatar for Team China 22. Team China 1 pt. 8,046
  3. Avatar for Rice Biochemistry 301 2020_2021 23. Rice Biochemistry 301 2020_2021 1 pt. 5,091
  1. Avatar for Hellcat6 91. Hellcat6 Lv 1 2 pts. 8,636
  2. Avatar for antibot215 92. antibot215 Lv 1 2 pts. 8,630
  3. Avatar for GenGF 93. GenGF Lv 1 2 pts. 8,623
  4. Avatar for zid 94. zid Lv 1 2 pts. 8,622
  5. Avatar for SouperGenious 95. SouperGenious Lv 1 2 pts. 8,621
  6. Avatar for rinze 96. rinze Lv 1 2 pts. 8,620
  7. Avatar for lconor 97. lconor Lv 1 2 pts. 8,609
  8. Avatar for Vincera 98. Vincera Lv 1 1 pt. 8,609
  9. Avatar for ehhan2018 99. ehhan2018 Lv 1 1 pt. 8,568
  10. Avatar for RockOn 100. RockOn Lv 1 1 pt. 8,565

Comments