Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 8,157
  2. Avatar for Team China 22. Team China 1 pt. 8,046
  3. Avatar for Rice Biochemistry 301 2020_2021 23. Rice Biochemistry 301 2020_2021 1 pt. 5,091
  1. Avatar for ViJay7019 111. ViJay7019 Lv 1 1 pt. 8,460
  2. Avatar for frostschutz 112. frostschutz Lv 1 1 pt. 8,444
  3. Avatar for Willyanto 113. Willyanto Lv 1 1 pt. 8,436
  4. Avatar for molleke 114. molleke Lv 1 1 pt. 8,424
  5. Avatar for fobosfog 115. fobosfog Lv 1 1 pt. 8,412
  6. Avatar for alwan2018 116. alwan2018 Lv 1 1 pt. 8,404
  7. Avatar for Anfinsen_slept_here 117. Anfinsen_slept_here Lv 1 1 pt. 8,361
  8. Avatar for Knoblerine 118. Knoblerine Lv 1 1 pt. 8,361
  9. Avatar for congautruc 119. congautruc Lv 1 1 pt. 8,361
  10. Avatar for TePie 120. TePie Lv 1 1 pt. 8,341

Comments