Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 8,157
  2. Avatar for Team China 22. Team China 1 pt. 8,046

  1. Avatar for DeMers_253 131. DeMers_253 Lv 1 1 pt. 8,177
  2. Avatar for 01010011111 132. 01010011111 Lv 1 1 pt. 8,175
  3. Avatar for jdmclure 133. jdmclure Lv 1 1 pt. 8,174
  4. Avatar for Keegan12 134. Keegan12 Lv 1 1 pt. 8,157
  5. Avatar for wozzarelli 135. wozzarelli Lv 1 1 pt. 8,157
  6. Avatar for Auntecedent 136. Auntecedent Lv 1 1 pt. 8,149
  7. Avatar for ti_go_Mars 137. ti_go_Mars Lv 1 1 pt. 8,142
  8. Avatar for henur 138. henur Lv 1 1 pt. 8,131
  9. Avatar for Charybdiss 139. Charybdiss Lv 1 1 pt. 8,129
  10. Avatar for lamoille 140. lamoille Lv 1 1 pt. 8,126

Comments