Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 8,157
  2. Avatar for Team China 22. Team China 1 pt. 8,046

  1. Avatar for luoyan 151. luoyan Lv 1 1 pt. 7,985
  2. Avatar for hieu 152. hieu Lv 1 1 pt. 7,890
  3. Avatar for 181818 153. 181818 Lv 1 1 pt. 7,890
  4. Avatar for theman9 154. theman9 Lv 1 1 pt. 7,884
  5. Avatar for Unsleeper 155. Unsleeper Lv 1 1 pt. 7,484
  6. Avatar for lvanonse 156. lvanonse Lv 1 1 pt. 6,078
  7. Avatar for ekd2 157. ekd2 Lv 1 1 pt. 5,091
  8. Avatar for Hollinas 158. Hollinas Lv 1 1 pt. 5,091
  9. Avatar for aveannem 159. aveannem Lv 1 1 pt. 5,091
  10. Avatar for AntonioPerro 160. AntonioPerro Lv 1 1 pt. 5,091

Comments