Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 8,157
  2. Avatar for Team China 22. Team China 1 pt. 8,046
  3. Avatar for Rice Biochemistry 301 2020_2021 23. Rice Biochemistry 301 2020_2021 1 pt. 5,091
  1. Avatar for phi16 31. phi16 Lv 1 36 pts. 8,995
  2. Avatar for Simek 32. Simek Lv 1 35 pts. 8,987
  3. Avatar for YeshuaLives 33. YeshuaLives Lv 1 33 pts. 8,980
  4. Avatar for Merf 34. Merf Lv 1 32 pts. 8,980
  5. Avatar for Blipperman 35. Blipperman Lv 1 31 pts. 8,978
  6. Avatar for stomjoh 36. stomjoh Lv 1 30 pts. 8,976
  7. Avatar for Mark- 37. Mark- Lv 1 28 pts. 8,972
  8. Avatar for pvc78 38. pvc78 Lv 1 27 pts. 8,961
  9. Avatar for tarimo 39. tarimo Lv 1 26 pts. 8,960
  10. Avatar for guineapig 40. guineapig Lv 1 25 pts. 8,950

Comments