Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 8,157
  2. Avatar for Team China 22. Team China 1 pt. 8,046
  3. Avatar for Rice Biochemistry 301 2020_2021 23. Rice Biochemistry 301 2020_2021 1 pt. 5,091
  1. Avatar for frood66 41. frood66 Lv 1 24 pts. 8,948
  2. Avatar for katling 42. katling Lv 1 23 pts. 8,945
  3. Avatar for jobo0502 43. jobo0502 Lv 1 22 pts. 8,935
  4. Avatar for WBarme1234 44. WBarme1234 Lv 1 21 pts. 8,920
  5. Avatar for diamonddays 45. diamonddays Lv 1 21 pts. 8,913
  6. Avatar for cbwest 46. cbwest Lv 1 20 pts. 8,908
  7. Avatar for crpainter 47. crpainter Lv 1 19 pts. 8,907
  8. Avatar for Vinara 48. Vinara Lv 1 18 pts. 8,888
  9. Avatar for georg137 49. georg137 Lv 1 17 pts. 8,887
  10. Avatar for Bletchley Park 50. Bletchley Park Lv 1 17 pts. 8,883

Comments