Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 8,157
  2. Avatar for Team China 22. Team China 1 pt. 8,046

  1. Avatar for Altercomp 61. Altercomp Lv 1 10 pts. 8,808
  2. Avatar for ourtown 62. ourtown Lv 1 10 pts. 8,800
  3. Avatar for isaksson 63. isaksson Lv 1 9 pts. 8,796
  4. Avatar for andromeda72 64. andromeda72 Lv 1 9 pts. 8,781
  5. Avatar for heather-1 65. heather-1 Lv 1 8 pts. 8,775
  6. Avatar for benrh 66. benrh Lv 1 8 pts. 8,767
  7. Avatar for JasperD 67. JasperD Lv 1 7 pts. 8,765
  8. Avatar for alwen 68. alwen Lv 1 7 pts. 8,763
  9. Avatar for MrZanav 69. MrZanav Lv 1 7 pts. 8,760
  10. Avatar for Arne Heessels 70. Arne Heessels Lv 1 6 pts. 8,753

Comments