Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 8,157
  2. Avatar for Team China 22. Team China 1 pt. 8,046
  3. Avatar for Rice Biochemistry 301 2020_2021 23. Rice Biochemistry 301 2020_2021 1 pt. 5,091
  1. Avatar for silent gene 71. silent gene Lv 1 6 pts. 8,753
  2. Avatar for dbuske 72. dbuske Lv 1 6 pts. 8,743
  3. Avatar for Alistair69 73. Alistair69 Lv 1 6 pts. 8,732
  4. Avatar for Flagg65a 74. Flagg65a Lv 1 5 pts. 8,727
  5. Avatar for cobaltteal 75. cobaltteal Lv 1 5 pts. 8,721
  6. Avatar for Marvelz 76. Marvelz Lv 1 5 pts. 8,719
  7. Avatar for PlagueRat 77. PlagueRat Lv 1 4 pts. 8,716
  8. Avatar for Squirrely 78. Squirrely Lv 1 4 pts. 8,715
  9. Avatar for Lyshi2018 79. Lyshi2018 Lv 1 4 pts. 8,713
  10. Avatar for rezaefar 80. rezaefar Lv 1 4 pts. 8,711

Comments