Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 8,157
  2. Avatar for Team China 22. Team China 1 pt. 8,046
  3. Avatar for Rice Biochemistry 301 2020_2021 23. Rice Biochemistry 301 2020_2021 1 pt. 5,091
  1. Avatar for Natuhaka 81. Natuhaka Lv 1 4 pts. 8,709
  2. Avatar for veroxdraco 82. veroxdraco Lv 1 3 pts. 8,703
  3. Avatar for baiyuncanggou 83. baiyuncanggou Lv 1 3 pts. 8,690
  4. Avatar for rabamino12358 84. rabamino12358 Lv 1 3 pts. 8,671
  5. Avatar for gurch 85. gurch Lv 1 3 pts. 8,664
  6. Avatar for oureion 86. oureion Lv 1 3 pts. 8,657
  7. Avatar for altejoh 87. altejoh Lv 1 3 pts. 8,655
  8. Avatar for alcor29 88. alcor29 Lv 1 2 pts. 8,653
  9. Avatar for Artoria2e5 89. Artoria2e5 Lv 1 2 pts. 8,650
  10. Avatar for ppp6 90. ppp6 Lv 1 2 pts. 8,640

Comments