Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,253
  2. Avatar for HMT heritage 2. HMT heritage 80 pts. 9,225
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,180
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 9,171
  5. Avatar for Go Science 5. Go Science 37 pts. 9,161
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,111
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,057
  8. Avatar for Marvin's bunch 8. Marvin's bunch 15 pts. 9,052
  9. Avatar for Russian team 9. Russian team 11 pts. 9,006
  10. Avatar for Contenders 10. Contenders 8 pts. 8,972
  1. Avatar for harvardman 101. harvardman Lv 1 1 pt. 8,565
  2. Avatar for Kevonni 102. Kevonni Lv 1 1 pt. 8,554
  3. Avatar for Znaika 103. Znaika Lv 1 1 pt. 8,541
  4. Avatar for Alpha-KetoGlutarate1301 104. Alpha-KetoGlutarate1301 Lv 1 1 pt. 8,541
  5. Avatar for Maerlyn138 105. Maerlyn138 Lv 1 1 pt. 8,531
  6. Avatar for pfirth 106. pfirth Lv 1 1 pt. 8,516
  7. Avatar for SiPot2018 107. SiPot2018 Lv 1 1 pt. 8,507
  8. Avatar for erexer 108. erexer Lv 1 1 pt. 8,499
  9. Avatar for mark4mars 109. mark4mars Lv 1 1 pt. 8,498
  10. Avatar for vizhu2018 110. vizhu2018 Lv 1 1 pt. 8,481

Comments