Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,253
  2. Avatar for HMT heritage 2. HMT heritage 80 pts. 9,225
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,180
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 9,171
  5. Avatar for Go Science 5. Go Science 37 pts. 9,161
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,111
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,057
  8. Avatar for Marvin's bunch 8. Marvin's bunch 15 pts. 9,052
  9. Avatar for Russian team 9. Russian team 11 pts. 9,006
  10. Avatar for Contenders 10. Contenders 8 pts. 8,972
  1. Avatar for hajtogato 121. hajtogato Lv 1 1 pt. 8,334
  2. Avatar for Nolan2E 122. Nolan2E Lv 1 1 pt. 8,309
  3. Avatar for doctaven 123. doctaven Lv 1 1 pt. 8,305
  4. Avatar for jeremiasivan 124. jeremiasivan Lv 1 1 pt. 8,299
  5. Avatar for mrfu 125. mrfu Lv 1 1 pt. 8,293
  6. Avatar for martinf 126. martinf Lv 1 1 pt. 8,279
  7. Avatar for yavij2019 127. yavij2019 Lv 1 1 pt. 8,263
  8. Avatar for NR22 128. NR22 Lv 1 1 pt. 8,216
  9. Avatar for MuckeMcFly 129. MuckeMcFly Lv 1 1 pt. 8,208
  10. Avatar for evapsy 130. evapsy Lv 1 1 pt. 8,193

Comments