Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 4 pts. 10,160
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,954
  3. Avatar for GENE 433 13. GENE 433 2 pts. 9,828
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,825
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,620
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,470
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,824
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 8,359
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,939
  10. Avatar for Rice Biochemistry 301 2020_2021 20. Rice Biochemistry 301 2020_2021 1 pt. 5,122
  1. Avatar for Lyshi2018 101. Lyshi2018 Lv 1 1 pt. 9,382
  2. Avatar for Silvercraft 102. Silvercraft Lv 1 1 pt. 9,373
  3. Avatar for Squirrely 103. Squirrely Lv 1 1 pt. 9,359
  4. Avatar for vizhu2018 104. vizhu2018 Lv 1 1 pt. 9,334
  5. Avatar for ourtown 105. ourtown Lv 1 1 pt. 9,326
  6. Avatar for boondog 106. boondog Lv 1 1 pt. 9,294
  7. Avatar for ViJay7019 107. ViJay7019 Lv 1 1 pt. 9,249
  8. Avatar for benz888 108. benz888 Lv 1 1 pt. 9,229
  9. Avatar for ManVsYard 109. ManVsYard Lv 1 1 pt. 9,201
  10. Avatar for Poovent 110. Poovent Lv 1 1 pt. 9,183

Comments