Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 4 pts. 10,160
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,954
  3. Avatar for GENE 433 13. GENE 433 2 pts. 9,828
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,825
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,620
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,470
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,824
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 8,359
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,939
  10. Avatar for Rice Biochemistry 301 2020_2021 20. Rice Biochemistry 301 2020_2021 1 pt. 5,122
  1. Avatar for vakobo 11. vakobo Lv 1 73 pts. 10,347
  2. Avatar for O Seki To 12. O Seki To Lv 1 70 pts. 10,335
  3. Avatar for gdnskye 13. gdnskye Lv 1 68 pts. 10,332
  4. Avatar for johnmitch 14. johnmitch Lv 1 66 pts. 10,327
  5. Avatar for fpc 15. fpc Lv 1 63 pts. 10,325
  6. Avatar for Timo van der Laan 16. Timo van der Laan Lv 1 61 pts. 10,324
  7. Avatar for retiredmichael 17. retiredmichael Lv 1 59 pts. 10,324
  8. Avatar for Skippysk8s 18. Skippysk8s Lv 1 57 pts. 10,319
  9. Avatar for MicElephant 19. MicElephant Lv 1 55 pts. 10,311
  10. Avatar for crpainter 20. crpainter Lv 1 53 pts. 10,308

Comments