Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 4 pts. 10,160
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,954
  3. Avatar for GENE 433 13. GENE 433 2 pts. 9,828
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,825
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,620
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,470
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,824
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 8,359
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,939
  10. Avatar for Rice Biochemistry 301 2020_2021 20. Rice Biochemistry 301 2020_2021 1 pt. 5,122
  1. Avatar for TastyMunchies 51. TastyMunchies Lv 1 15 pts. 10,051
  2. Avatar for christioanchauvin 52. christioanchauvin Lv 1 15 pts. 10,046
  3. Avatar for katling 53. katling Lv 1 14 pts. 10,035
  4. Avatar for Maerlyn138 54. Maerlyn138 Lv 1 13 pts. 10,022
  5. Avatar for cobaltteal 55. cobaltteal Lv 1 13 pts. 10,008
  6. Avatar for Glen B 56. Glen B Lv 1 12 pts. 10,005
  7. Avatar for Idiotboy 57. Idiotboy Lv 1 12 pts. 9,997
  8. Avatar for Vinara 58. Vinara Lv 1 11 pts. 9,994
  9. Avatar for Crossed Sticks 59. Crossed Sticks Lv 1 11 pts. 9,990
  10. Avatar for Alpha-KetoGlutarate1301 60. Alpha-KetoGlutarate1301 Lv 1 10 pts. 9,958

Comments