Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 4 pts. 10,160
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,954
  3. Avatar for GENE 433 13. GENE 433 2 pts. 9,828
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,825
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,620
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,470
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,824
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 8,359
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,939
  10. Avatar for Rice Biochemistry 301 2020_2021 20. Rice Biochemistry 301 2020_2021 1 pt. 5,122
  1. Avatar for andromeda72 61. andromeda72 Lv 1 10 pts. 9,954
  2. Avatar for YeshuaLives 62. YeshuaLives Lv 1 9 pts. 9,939
  3. Avatar for Deleted player 63. Deleted player pts. 9,918
  4. Avatar for nicobul 64. nicobul Lv 1 8 pts. 9,910
  5. Avatar for joremen 65. joremen Lv 1 8 pts. 9,907
  6. Avatar for altejoh 66. altejoh Lv 1 8 pts. 9,905
  7. Avatar for Arne Heessels 67. Arne Heessels Lv 1 7 pts. 9,903
  8. Avatar for Simek 68. Simek Lv 1 7 pts. 9,853
  9. Avatar for ironchefnorse 69. ironchefnorse Lv 1 6 pts. 9,845
  10. Avatar for Flagg65a 70. Flagg65a Lv 1 6 pts. 9,841

Comments