Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,122
  1. Avatar for gurch 111. gurch Lv 1 1 pt. 9,165
  2. Avatar for Vincera 112. Vincera Lv 1 1 pt. 9,145
  3. Avatar for frostschutz 113. frostschutz Lv 1 1 pt. 9,138
  4. Avatar for bergie72 114. bergie72 Lv 1 1 pt. 9,137
  5. Avatar for erexer 115. erexer Lv 1 1 pt. 9,116
  6. Avatar for DodoBird 116. DodoBird Lv 1 1 pt. 9,070
  7. Avatar for alwan2018 117. alwan2018 Lv 1 1 pt. 9,055
  8. Avatar for RootBeerSwordsman 118. RootBeerSwordsman Lv 1 1 pt. 9,029
  9. Avatar for Willyanto 119. Willyanto Lv 1 1 pt. 8,958
  10. Avatar for NotJim99 120. NotJim99 Lv 1 1 pt. 8,942

Comments