Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,550
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,495
  3. Avatar for Go Science 3. Go Science 60 pts. 10,483
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,390
  5. Avatar for Russian team 5. Russian team 33 pts. 10,347
  6. Avatar for HMT heritage 6. HMT heritage 24 pts. 10,335
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,324
  8. Avatar for Contenders 8. Contenders 12 pts. 10,308
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 10,256
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,233
  1. Avatar for gurch 111. gurch Lv 1 1 pt. 9,165
  2. Avatar for Vincera 112. Vincera Lv 1 1 pt. 9,145
  3. Avatar for frostschutz 113. frostschutz Lv 1 1 pt. 9,138
  4. Avatar for bergie72 114. bergie72 Lv 1 1 pt. 9,137
  5. Avatar for erexer 115. erexer Lv 1 1 pt. 9,116
  6. Avatar for DodoBird 116. DodoBird Lv 1 1 pt. 9,070
  7. Avatar for alwan2018 117. alwan2018 Lv 1 1 pt. 9,055
  8. Avatar for RootBeerSwordsman 118. RootBeerSwordsman Lv 1 1 pt. 9,029
  9. Avatar for Willyanto 119. Willyanto Lv 1 1 pt. 8,958
  10. Avatar for NotJim99 120. NotJim99 Lv 1 1 pt. 8,942

Comments