Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,122
  1. Avatar for congautruc 121. congautruc Lv 1 1 pt. 8,905
  2. Avatar for ti_go_Mars 122. ti_go_Mars Lv 1 1 pt. 8,885
  3. Avatar for justjustin 123. justjustin Lv 1 1 pt. 8,828
  4. Avatar for hajtogato 124. hajtogato Lv 1 1 pt. 8,824
  5. Avatar for doctaven 125. doctaven Lv 1 1 pt. 8,824
  6. Avatar for fisherlr777 126. fisherlr777 Lv 1 1 pt. 8,775
  7. Avatar for Mao Mao 127. Mao Mao Lv 1 1 pt. 8,757
  8. Avatar for Znaika 128. Znaika Lv 1 1 pt. 8,708
  9. Avatar for srrao2019 129. srrao2019 Lv 1 1 pt. 8,673
  10. Avatar for xplocast1 130. xplocast1 Lv 1 1 pt. 8,561

Comments