Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,550
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,495
  3. Avatar for Go Science 3. Go Science 60 pts. 10,483
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,390
  5. Avatar for Russian team 5. Russian team 33 pts. 10,347
  6. Avatar for HMT heritage 6. HMT heritage 24 pts. 10,335
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,324
  8. Avatar for Contenders 8. Contenders 12 pts. 10,308
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 10,256
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,233
  1. Avatar for congautruc 121. congautruc Lv 1 1 pt. 8,905
  2. Avatar for ti_go_Mars 122. ti_go_Mars Lv 1 1 pt. 8,885
  3. Avatar for justjustin 123. justjustin Lv 1 1 pt. 8,828
  4. Avatar for hajtogato 124. hajtogato Lv 1 1 pt. 8,824
  5. Avatar for doctaven 125. doctaven Lv 1 1 pt. 8,824
  6. Avatar for fisherlr777 126. fisherlr777 Lv 1 1 pt. 8,775
  7. Avatar for Mao Mao 127. Mao Mao Lv 1 1 pt. 8,757
  8. Avatar for Znaika 128. Znaika Lv 1 1 pt. 8,708
  9. Avatar for srrao2019 129. srrao2019 Lv 1 1 pt. 8,673
  10. Avatar for xplocast1 130. xplocast1 Lv 1 1 pt. 8,561

Comments