Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,122
  1. Avatar for bcmccjr01 131. bcmccjr01 Lv 1 1 pt. 8,546
  2. Avatar for joshmiller 132. joshmiller Lv 1 1 pt. 8,535
  3. Avatar for TePie 133. TePie Lv 1 1 pt. 8,515
  4. Avatar for Anton Larin 134. Anton Larin Lv 1 1 pt. 8,514
  5. Avatar for Architekt 135. Architekt Lv 1 1 pt. 8,415
  6. Avatar for Deleted player 136. Deleted player pts. 8,409
  7. Avatar for mrfu 137. mrfu Lv 1 1 pt. 8,359
  8. Avatar for Liana_Cole 138. Liana_Cole Lv 1 1 pt. 8,301
  9. Avatar for DipsyDoodle2016 139. DipsyDoodle2016 Lv 1 1 pt. 8,227
  10. Avatar for Giantbluefish 140. Giantbluefish Lv 1 1 pt. 8,201

Comments