Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,550
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,495
  3. Avatar for Go Science 3. Go Science 60 pts. 10,483
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,390
  5. Avatar for Russian team 5. Russian team 33 pts. 10,347
  6. Avatar for HMT heritage 6. HMT heritage 24 pts. 10,335
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,324
  8. Avatar for Contenders 8. Contenders 12 pts. 10,308
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 10,256
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,233
  1. Avatar for bcmccjr01 131. bcmccjr01 Lv 1 1 pt. 8,546
  2. Avatar for joshmiller 132. joshmiller Lv 1 1 pt. 8,535
  3. Avatar for TePie 133. TePie Lv 1 1 pt. 8,515
  4. Avatar for Anton Larin 134. Anton Larin Lv 1 1 pt. 8,514
  5. Avatar for Architekt 135. Architekt Lv 1 1 pt. 8,415
  6. Avatar for Deleted player 136. Deleted player pts. 8,409
  7. Avatar for mrfu 137. mrfu Lv 1 1 pt. 8,359
  8. Avatar for Liana_Cole 138. Liana_Cole Lv 1 1 pt. 8,301
  9. Avatar for DipsyDoodle2016 139. DipsyDoodle2016 Lv 1 1 pt. 8,227
  10. Avatar for Giantbluefish 140. Giantbluefish Lv 1 1 pt. 8,201

Comments