Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,122
  1. Avatar for angem1 141. angem1 Lv 1 1 pt. 8,152
  2. Avatar for lamoille 142. lamoille Lv 1 1 pt. 8,136
  3. Avatar for Ricardo Oliveira 143. Ricardo Oliveira Lv 1 1 pt. 8,095
  4. Avatar for Xurane 144. Xurane Lv 1 1 pt. 8,077
  5. Avatar for jchartron 145. jchartron Lv 1 1 pt. 8,035
  6. Avatar for firejuggler 146. firejuggler Lv 1 1 pt. 8,003
  7. Avatar for Bithalbierer 147. Bithalbierer Lv 1 1 pt. 7,939
  8. Avatar for victoria4 148. victoria4 Lv 1 1 pt. 7,909
  9. Avatar for aday1 149. aday1 Lv 1 1 pt. 7,834
  10. Avatar for origar121 150. origar121 Lv 1 1 pt. 7,411

Comments