Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,550
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,495
  3. Avatar for Go Science 3. Go Science 60 pts. 10,483
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,390
  5. Avatar for Russian team 5. Russian team 33 pts. 10,347
  6. Avatar for HMT heritage 6. HMT heritage 24 pts. 10,335
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,324
  8. Avatar for Contenders 8. Contenders 12 pts. 10,308
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 10,256
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,233
  1. Avatar for angem1 141. angem1 Lv 1 1 pt. 8,152
  2. Avatar for lamoille 142. lamoille Lv 1 1 pt. 8,136
  3. Avatar for Ricardo Oliveira 143. Ricardo Oliveira Lv 1 1 pt. 8,095
  4. Avatar for Xurane 144. Xurane Lv 1 1 pt. 8,077
  5. Avatar for jchartron 145. jchartron Lv 1 1 pt. 8,035
  6. Avatar for firejuggler 146. firejuggler Lv 1 1 pt. 8,003
  7. Avatar for Bithalbierer 147. Bithalbierer Lv 1 1 pt. 7,939
  8. Avatar for victoria4 148. victoria4 Lv 1 1 pt. 7,909
  9. Avatar for aday1 149. aday1 Lv 1 1 pt. 7,834
  10. Avatar for origar121 150. origar121 Lv 1 1 pt. 7,411

Comments