Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,122
  1. Avatar for 01010011111 151. 01010011111 Lv 1 1 pt. 7,222
  2. Avatar for Holyaws 152. Holyaws Lv 1 1 pt. 6,770
  3. Avatar for phi16 153. phi16 Lv 1 1 pt. 6,330
  4. Avatar for Gemmer0 154. Gemmer0 Lv 1 1 pt. 6,318
  5. Avatar for 4030_18_Szyca 155. 4030_18_Szyca Lv 1 1 pt. 5,122
  6. Avatar for Allen Tao 156. Allen Tao Lv 1 1 pt. 5,122
  7. Avatar for Samuelferreira8 157. Samuelferreira8 Lv 1 1 pt. 5,122
  8. Avatar for bkoep 158. bkoep Lv 1 1 pt. 5,122
  9. Avatar for 4030_18_AbbyS 159. 4030_18_AbbyS Lv 1 1 pt. 5,122

Comments