Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,550
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,495
  3. Avatar for Go Science 3. Go Science 60 pts. 10,483
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,390
  5. Avatar for Russian team 5. Russian team 33 pts. 10,347
  6. Avatar for HMT heritage 6. HMT heritage 24 pts. 10,335
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,324
  8. Avatar for Contenders 8. Contenders 12 pts. 10,308
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 10,256
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,233
  1. Avatar for 01010011111 151. 01010011111 Lv 1 1 pt. 7,222
  2. Avatar for Holyaws 152. Holyaws Lv 1 1 pt. 6,770
  3. Avatar for phi16 153. phi16 Lv 1 1 pt. 6,330
  4. Avatar for Gemmer0 154. Gemmer0 Lv 1 1 pt. 6,318
  5. Avatar for 4030_18_Szyca 155. 4030_18_Szyca Lv 1 1 pt. 5,122
  6. Avatar for Allen Tao 156. Allen Tao Lv 1 1 pt. 5,122
  7. Avatar for Samuelferreira8 157. Samuelferreira8 Lv 1 1 pt. 5,122
  8. Avatar for bkoep 158. bkoep Lv 1 1 pt. 5,122
  9. Avatar for 4030_18_AbbyS 159. 4030_18_AbbyS Lv 1 1 pt. 5,122

Comments