Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,122
  1. Avatar for reefyrob 21. reefyrob Lv 1 51 pts. 10,287
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 50 pts. 10,287
  3. Avatar for robgee 23. robgee Lv 1 48 pts. 10,265
  4. Avatar for Museka 24. Museka Lv 1 46 pts. 10,256
  5. Avatar for pvc78 25. pvc78 Lv 1 44 pts. 10,256
  6. Avatar for jobo0502 26. jobo0502 Lv 1 43 pts. 10,253
  7. Avatar for georg137 27. georg137 Lv 1 41 pts. 10,249
  8. Avatar for WBarme1234 28. WBarme1234 Lv 1 40 pts. 10,238
  9. Avatar for Aminal88 29. Aminal88 Lv 1 38 pts. 10,233
  10. Avatar for silent gene 30. silent gene Lv 1 37 pts. 10,220

Comments