Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,122
  1. Avatar for reefyrob 21. reefyrob Lv 1 51 pts. 10,287
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 50 pts. 10,287
  3. Avatar for robgee 23. robgee Lv 1 48 pts. 10,265
  4. Avatar for Museka 24. Museka Lv 1 46 pts. 10,256
  5. Avatar for pvc78 25. pvc78 Lv 1 44 pts. 10,256
  6. Avatar for jobo0502 26. jobo0502 Lv 1 43 pts. 10,253
  7. Avatar for georg137 27. georg137 Lv 1 41 pts. 10,249
  8. Avatar for WBarme1234 28. WBarme1234 Lv 1 40 pts. 10,238
  9. Avatar for Aminal88 29. Aminal88 Lv 1 38 pts. 10,233
  10. Avatar for silent gene 30. silent gene Lv 1 37 pts. 10,220

Comments