Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,550
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,495
  3. Avatar for Go Science 3. Go Science 60 pts. 10,483
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,390
  5. Avatar for Russian team 5. Russian team 33 pts. 10,347
  6. Avatar for HMT heritage 6. HMT heritage 24 pts. 10,335
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,324
  8. Avatar for Contenders 8. Contenders 12 pts. 10,308
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 10,256
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,233
  1. Avatar for reefyrob 21. reefyrob Lv 1 51 pts. 10,287
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 50 pts. 10,287
  3. Avatar for robgee 23. robgee Lv 1 48 pts. 10,265
  4. Avatar for Museka 24. Museka Lv 1 46 pts. 10,256
  5. Avatar for pvc78 25. pvc78 Lv 1 44 pts. 10,256
  6. Avatar for jobo0502 26. jobo0502 Lv 1 43 pts. 10,253
  7. Avatar for georg137 27. georg137 Lv 1 41 pts. 10,249
  8. Avatar for WBarme1234 28. WBarme1234 Lv 1 40 pts. 10,238
  9. Avatar for Aminal88 29. Aminal88 Lv 1 38 pts. 10,233
  10. Avatar for silent gene 30. silent gene Lv 1 37 pts. 10,220

Comments