Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,122
  1. Avatar for Natuhaka 71. Natuhaka Lv 1 6 pts. 9,828
  2. Avatar for oureion 72. oureion Lv 1 6 pts. 9,825
  3. Avatar for jausmh 73. jausmh Lv 1 5 pts. 9,820
  4. Avatar for lconor 74. lconor Lv 1 5 pts. 9,785
  5. Avatar for stomjoh 75. stomjoh Lv 1 5 pts. 9,769
  6. Avatar for rezaefar 76. rezaefar Lv 1 5 pts. 9,759
  7. Avatar for benrh 77. benrh Lv 1 4 pts. 9,741
  8. Avatar for alwen 78. alwen Lv 1 4 pts. 9,736
  9. Avatar for harvardman 79. harvardman Lv 1 4 pts. 9,697
  10. Avatar for Cagdason 80. Cagdason Lv 1 4 pts. 9,685

Comments