Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,550
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,495
  3. Avatar for Go Science 3. Go Science 60 pts. 10,483
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,390
  5. Avatar for Russian team 5. Russian team 33 pts. 10,347
  6. Avatar for HMT heritage 6. HMT heritage 24 pts. 10,335
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,324
  8. Avatar for Contenders 8. Contenders 12 pts. 10,308
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 10,256
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,233
  1. Avatar for Natuhaka 71. Natuhaka Lv 1 6 pts. 9,828
  2. Avatar for oureion 72. oureion Lv 1 6 pts. 9,825
  3. Avatar for jausmh 73. jausmh Lv 1 5 pts. 9,820
  4. Avatar for lconor 74. lconor Lv 1 5 pts. 9,785
  5. Avatar for stomjoh 75. stomjoh Lv 1 5 pts. 9,769
  6. Avatar for rezaefar 76. rezaefar Lv 1 5 pts. 9,759
  7. Avatar for benrh 77. benrh Lv 1 4 pts. 9,741
  8. Avatar for alwen 78. alwen Lv 1 4 pts. 9,736
  9. Avatar for harvardman 79. harvardman Lv 1 4 pts. 9,697
  10. Avatar for Cagdason 80. Cagdason Lv 1 4 pts. 9,685

Comments