Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Androids 11. Androids 4 pts. 9,710
  2. Avatar for HMT heritage 12. HMT heritage 3 pts. 9,670
  3. Avatar for GENE 433 13. GENE 433 2 pts. 9,573
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,482
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,462
  6. Avatar for freefolder 16. freefolder 1 pt. 9,456
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 9,353
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 9,334
  9. Avatar for Deleted group 19. Deleted group pts. 8,999
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,997
  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 9,905
  2. Avatar for Deleted player 2. Deleted player 82 pts. 9,903
  3. Avatar for LociOiling 3. LociOiling Lv 1 66 pts. 9,899
  4. Avatar for reefyrob 4. reefyrob Lv 1 53 pts. 9,877
  5. Avatar for silent gene 5. silent gene Lv 1 42 pts. 9,817
  6. Avatar for Znaika 6. Znaika Lv 1 33 pts. 9,815
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 26 pts. 9,809
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 20 pts. 9,805
  9. Avatar for Galaxie 9. Galaxie Lv 1 15 pts. 9,803
  10. Avatar for orily1337 10. orily1337 Lv 1 11 pts. 9,789

Comments